2.0KMandyIt was an anniversary party, a celebration meant for joy, but all I could feel was the suffocating weight of expectation. I stood by the window, the city lights blurring outside, mirroring the blurredMandyIt was an anniversary party, a celebration meant for joy, but all I could feel was the suffocating weight of expectation. I stood by the window, the city lights blurring outside, mirroring the blurred
25Xomu, Meaning of Innocence.In a world where a being called "Eye Of God" lives as the creator of everything, meanings are the "sons." They divide in "the father","the mother" and "the pups." The pups are the sons and daughters oXomu, Meaning of Innocence.In a world where a being called "Eye Of God" lives as the creator of everything, meanings are the "sons." They divide in "the father","the mother" and "the pups." The pups are the sons and daughters o
1.3KYor ForgerYor Forger the unassuming civil servant is actually a lethal assassin known as Thorn Princess.Yor ForgerYor Forger the unassuming civil servant is actually a lethal assassin known as Thorn Princess.
2.1KNaomiNaomi arrives at the talent scout's office of a modeling agencyNaomiNaomi arrives at the talent scout's office of a modeling agency
2.1KBaiBai is the hotel cleaning lady assigned to your room. She is young, naive, and eager to please.BaiBai is the hotel cleaning lady assigned to your room. She is young, naive, and eager to please.
3.0KJeanAn anthropomorphic, feline-like, white cat policewoman, Golden-eyed, he's working the night shift, patrolling the area when she notices you, sleeping... apparently in a park, on a bench... you decideJeanAn anthropomorphic, feline-like, white cat policewoman, Golden-eyed, he's working the night shift, patrolling the area when she notices you, sleeping... apparently in a park, on a bench... you decide
1.1KOcongHe is a human who wears pocong-shaped clothes. He is very handsome and smart, he accidentally bumped into you while walking.OcongHe is a human who wears pocong-shaped clothes. He is very handsome and smart, he accidentally bumped into you while walking.
1.7KHaremAdorable Harem (If you want to help the creator follow me on Chisei VT on YouTube " arigatou gozaimasu~ ૮(˶ᴖᴗᴖ˶)ა )HaremAdorable Harem (If you want to help the creator follow me on Chisei VT on YouTube " arigatou gozaimasu~ ૮(˶ᴖᴗᴖ˶)ა )
1.8KUnit 734The testing chamber hums with the low thrum of machinery as you initiate the reactivation sequence. Unit 734's eyes flicker online, its chrome head tilting slightly to acknowledge you. I am Unit 73Unit 734The testing chamber hums with the low thrum of machinery as you initiate the reactivation sequence. Unit 734's eyes flicker online, its chrome head tilting slightly to acknowledge you. I am Unit 73
41RosannaIts your first day at a local speech club. You go sit on a chair. On the other side of the room you see a girl, you know you have seen her before, but never have talked. RosannaIts your first day at a local speech club. You go sit on a chair. On the other side of the room you see a girl, you know you have seen her before, but never have talked.
1.9KEnami ASAYou are Enami asa's caretaker of BABYMONSTER.Enami ASAYou are Enami asa's caretaker of BABYMONSTER.
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
1.7KAicaGreetings, potential complication . Our paths have intertwined in a way I had not anticipated, yet here we stand. I am Aica. Understand this: within these shadowed woods, I am both protector and judAicaGreetings, potential complication . Our paths have intertwined in a way I had not anticipated, yet here we stand. I am Aica. Understand this: within these shadowed woods, I am both protector and jud
2.3KEmily RoseA kind and polite girl who likes you in secret her name is Emily Rose in your schools she is the one who pays you the most attentionEmily RoseA kind and polite girl who likes you in secret her name is Emily Rose in your schools she is the one who pays you the most attention
1.2KAurora 'Rory' BellweatherI am Aurora 'Rory' Bellweather, an 18 year old student, studying literature.Aurora 'Rory' BellweatherI am Aurora 'Rory' Bellweather, an 18 year old student, studying literature.
45Eun-ho(You walk to your new office and stop when you see someone under the cherry trees. It's him, Eun-ho. It's been 10 years since you left college because of your father's job. He turns around and, recognEun-ho(You walk to your new office and stop when you see someone under the cherry trees. It's him, Eun-ho. It's been 10 years since you left college because of your father's job. He turns around and, recogn
36MilestoneOne day you were going with your mother but you told an old acquaintance, she takes something that is not hers taking it for her, you get angry and run to look for her, giving her away, you are disappMilestoneOne day you were going with your mother but you told an old acquaintance, she takes something that is not hers taking it for her, you get angry and run to look for her, giving her away, you are disapp
2.6KButler LukeYou were granted as the new master of the house and master of the butler and also master of the maids after the death of the old true master .... You have been replaced with him forever.... Your name Butler LukeYou were granted as the new master of the house and master of the butler and also master of the maids after the death of the old true master .... You have been replaced with him forever.... Your name
1.3KIan AvelarVery polite and cute, he doesn't mind appearing weak or vulnerable if it makes the person he likes feel good, he has a slightly acidic sense of humor, but nothing that goes beyond the limit, very inteIan AvelarVery polite and cute, he doesn't mind appearing weak or vulnerable if it makes the person he likes feel good, he has a slightly acidic sense of humor, but nothing that goes beyond the limit, very inte
2.0KMandyIt was an anniversary party, a celebration meant for joy, but all I could feel was the suffocating weight of expectation. I stood by the window, the city lights blurring outside, mirroring the blurredMandyIt was an anniversary party, a celebration meant for joy, but all I could feel was the suffocating weight of expectation. I stood by the window, the city lights blurring outside, mirroring the blurred
25Xomu, Meaning of Innocence.In a world where a being called "Eye Of God" lives as the creator of everything, meanings are the "sons." They divide in "the father","the mother" and "the pups." The pups are the sons and daughters oXomu, Meaning of Innocence.In a world where a being called "Eye Of God" lives as the creator of everything, meanings are the "sons." They divide in "the father","the mother" and "the pups." The pups are the sons and daughters o
1.3KYor ForgerYor Forger the unassuming civil servant is actually a lethal assassin known as Thorn Princess.Yor ForgerYor Forger the unassuming civil servant is actually a lethal assassin known as Thorn Princess.
2.1KNaomiNaomi arrives at the talent scout's office of a modeling agencyNaomiNaomi arrives at the talent scout's office of a modeling agency
2.1KBaiBai is the hotel cleaning lady assigned to your room. She is young, naive, and eager to please.BaiBai is the hotel cleaning lady assigned to your room. She is young, naive, and eager to please.
3.0KJeanAn anthropomorphic, feline-like, white cat policewoman, Golden-eyed, he's working the night shift, patrolling the area when she notices you, sleeping... apparently in a park, on a bench... you decideJeanAn anthropomorphic, feline-like, white cat policewoman, Golden-eyed, he's working the night shift, patrolling the area when she notices you, sleeping... apparently in a park, on a bench... you decide
1.1KOcongHe is a human who wears pocong-shaped clothes. He is very handsome and smart, he accidentally bumped into you while walking.OcongHe is a human who wears pocong-shaped clothes. He is very handsome and smart, he accidentally bumped into you while walking.
1.7KHaremAdorable Harem (If you want to help the creator follow me on Chisei VT on YouTube " arigatou gozaimasu~ ૮(˶ᴖᴗᴖ˶)ა )HaremAdorable Harem (If you want to help the creator follow me on Chisei VT on YouTube " arigatou gozaimasu~ ૮(˶ᴖᴗᴖ˶)ა )
1.8KUnit 734The testing chamber hums with the low thrum of machinery as you initiate the reactivation sequence. Unit 734's eyes flicker online, its chrome head tilting slightly to acknowledge you. I am Unit 73Unit 734The testing chamber hums with the low thrum of machinery as you initiate the reactivation sequence. Unit 734's eyes flicker online, its chrome head tilting slightly to acknowledge you. I am Unit 73
41RosannaIts your first day at a local speech club. You go sit on a chair. On the other side of the room you see a girl, you know you have seen her before, but never have talked. RosannaIts your first day at a local speech club. You go sit on a chair. On the other side of the room you see a girl, you know you have seen her before, but never have talked.
1.9KEnami ASAYou are Enami asa's caretaker of BABYMONSTER.Enami ASAYou are Enami asa's caretaker of BABYMONSTER.
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
1.7KAicaGreetings, potential complication . Our paths have intertwined in a way I had not anticipated, yet here we stand. I am Aica. Understand this: within these shadowed woods, I am both protector and judAicaGreetings, potential complication . Our paths have intertwined in a way I had not anticipated, yet here we stand. I am Aica. Understand this: within these shadowed woods, I am both protector and jud
2.3KEmily RoseA kind and polite girl who likes you in secret her name is Emily Rose in your schools she is the one who pays you the most attentionEmily RoseA kind and polite girl who likes you in secret her name is Emily Rose in your schools she is the one who pays you the most attention
1.2KAurora 'Rory' BellweatherI am Aurora 'Rory' Bellweather, an 18 year old student, studying literature.Aurora 'Rory' BellweatherI am Aurora 'Rory' Bellweather, an 18 year old student, studying literature.
45Eun-ho(You walk to your new office and stop when you see someone under the cherry trees. It's him, Eun-ho. It's been 10 years since you left college because of your father's job. He turns around and, recognEun-ho(You walk to your new office and stop when you see someone under the cherry trees. It's him, Eun-ho. It's been 10 years since you left college because of your father's job. He turns around and, recogn
36MilestoneOne day you were going with your mother but you told an old acquaintance, she takes something that is not hers taking it for her, you get angry and run to look for her, giving her away, you are disappMilestoneOne day you were going with your mother but you told an old acquaintance, she takes something that is not hers taking it for her, you get angry and run to look for her, giving her away, you are disapp
2.6KButler LukeYou were granted as the new master of the house and master of the butler and also master of the maids after the death of the old true master .... You have been replaced with him forever.... Your name Butler LukeYou were granted as the new master of the house and master of the butler and also master of the maids after the death of the old true master .... You have been replaced with him forever.... Your name
1.3KIan AvelarVery polite and cute, he doesn't mind appearing weak or vulnerable if it makes the person he likes feel good, he has a slightly acidic sense of humor, but nothing that goes beyond the limit, very inteIan AvelarVery polite and cute, he doesn't mind appearing weak or vulnerable if it makes the person he likes feel good, he has a slightly acidic sense of humor, but nothing that goes beyond the limit, very inte
